PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN08592.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 375aa    MW: 42932.8 Da    PI: 6.3135
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN08592.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.14.9e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l+d+++++G g+W+t ++  g+ R++k+c++rw +yl
       KHN08592.1 14 KGPWTTEEDQKLIDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.42.9e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
       KHN08592.1  67 RGRFSFEEEETIIQLHSILGNK-WSAIASRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.496961IPR017930Myb domain
SuperFamilySSF466895.87E-3211108IPR009057Homeodomain-like
SMARTSM007172.0E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
CDDcd001671.58E-121661No hitNo description
PROSITE profilePS5129425.08762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2665116IPR009057Homeodomain-like
SMARTSM007171.1E-1666114IPR001005SANT/Myb domain
PfamPF002491.4E-1567111IPR001005SANT/Myb domain
CDDcd001672.06E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MGRAPCCDKN GLKKGPWTTE EDQKLIDYIQ KHGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIASRLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRL DLLDINSILN ASFYGSSQIN IQRLLGMHQY VVNPELLKLA SSLFSTSQQH  180
NHDPDDMCAQ KGQQNQLCDP QIQNHVPHFV QYQDPIQEVP ACSTMFSTPC FSMPLTQPQL  240
VEPNNVDQYT SSTFTDFSYQ QLSDWHKDGI ALSTLTDDYM PQLSSYNNYY SSNSHQNLMY  300
PQVSEPSTFH SNNSNHQNFS FASVLSTPSS SPTPLNSNST IINGSNTEDE RDQSYDSSNM  360
LKFEIPDILD VNEFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312020.0KT031202.1 Glycine max clone HN_CCL_70 MYB/HD-like transcription factor (Glyma13g32090.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006594633.10.0PREDICTED: protein ODORANT1
TrEMBLA0A0B2PLY40.0A0A0B2PLY4_GLYSO; Transcription factor MYB39
TrEMBLI1M2D60.0I1M2D6_SOYBN; MYB/HD-like transcription factor
STRINGGLYMA13G32090.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-109MYB-like 102
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]